PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01977.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 428aa    MW: 48374 Da    PI: 6.5739
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01977.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.27.7e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++l+  ++++G g+W++ +++ g++R++k+c++rw +yl
       KHN01977.1 14 KGPWTPEEDQKLIAFIEKHGHGSWRALPAKAGLRRCGKSCRLRWSNYL 61
                     79********************************************97 PP

2Myb_DNA-binding52.98.3e-1767112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++ +++++++lG++ W++Ia++++ +Rt++++k++w+++l
       KHN01977.1  67 RGKFSLQEEQTIIQLHALLGNR-WSAIASHLP-KRTDNEIKNYWNTHL 112
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-25564IPR009057Homeodomain-like
PROSITE profilePS5129418.429961IPR017930Myb domain
SuperFamilySSF466892.09E-3011108IPR009057Homeodomain-like
SMARTSM007176.5E-151363IPR001005SANT/Myb domain
PfamPF002491.5E-161461IPR001005SANT/Myb domain
CDDcd001674.10E-111661No hitNo description
PROSITE profilePS5129425.62262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-2665116IPR009057Homeodomain-like
SMARTSM007174.8E-1766114IPR001005SANT/Myb domain
PfamPF002494.1E-1667112IPR001005SANT/Myb domain
CDDcd001671.39E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 428 aa     Download sequence    Send to blast
MGRSPCCEKT GLKKGPWTPE EDQKLIAFIE KHGHGSWRAL PAKAGLRRCG KSCRLRWSNY  60
LRPDIKRGKF SLQEEQTIIQ LHALLGNRWS AIASHLPKRT DNEIKNYWNT HLKKRLDKMG  120
IDPTTHKPKN ESLAYSKDGS NLGHMAQWES ARLEAEARLV RESKLQEQQN NLGPMSSPSS  180
TQITRLVLNK ITPLQQKQHS LPPCLDVLKA WQSSWSNNNN NINKYSSLND KKKTMHVPSM  240
YAMMLSNDDL ESPTSTLCFP ESVQMNNNNN NSNAMVSTNH VGLINENYLL PPTTLDEFII  300
TKSLGTTSSE GAIETVNGGG SDSWRYFTKH NNEEEQVETD EKTIMYDTIS CLQDDDGDIM  360
VAVEALRGAG YYGDDNSNNN NVTFTHLSSN VNNMVGFEND FDSNEDLAAV NLHVKFEENK  420
DYWNGMLN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-29121175109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003520088.10.0PREDICTED: transcription factor MYB51-like
TrEMBLA0A0B2P2R30.0A0A0B2P2R3_GLYSO; Transcription factor MYB39
STRINGGLYMA02G12266.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF83534127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15310.11e-103myb domain protein 16
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]